PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G037100.1
Common NameB456_009G037100, LOC105769009
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARF
Protein Properties Length: 1107aa    MW: 123565 Da    PI: 6.7947
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G037100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B368.49.6e-22126227199
                         EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                         f+k+lt sd++++g +++p++ ae++      +++++  ++l+ +d++ + W++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F   
  Gorai.009G037100.1 126 FCKTLTASDTSTHGGFSVPRRAAEKIfppldfSMQPPA-QELVARDLHENAWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFI-- 213
                         99*****************************9445444.38************************************************.. PP

                         SSSEE..EEEEE-S CS
                  B3  86 grsefelvvkvfrk 99 
                         ++ + +l+++++r+
  Gorai.009G037100.1 214 RDVKSQLLLGLRRA 227
                         45555578888886 PP

2Auxin_resp122.23.8e-40252334183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         aahaa++ s+F+++YnPras+seFvv+++k+ ka++++vs+GmRf+m+fete+s  rr++Gtv+g+sdldpvrW+nS+Wr+L+
  Gorai.009G037100.1 252 AAHAAANFSPFTIFYNPRASPSEFVVPLAKYYKAMYTQVSLGMRFRMMFETEESGVRRYMGTVTGISDLDPVRWKNSQWRNLQ 334
                         79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.27E-43116255IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.4E-40119241IPR015300DNA-binding pseudobarrel domain
CDDcd100172.93E-18125215No hitNo description
SMARTSM010192.7E-22126228IPR003340B3 DNA binding domain
PROSITE profilePS5086311.702126228IPR003340B3 DNA binding domain
PfamPF023624.0E-20126227IPR003340B3 DNA binding domain
PfamPF065075.5E-35252334IPR010525Auxin response factor
PfamPF023096.8E-109761065IPR033389AUX/IAA domain
PROSITE profilePS5174526.2939791072IPR000270PB1 domain
SuperFamilySSF542778.83E-99941057No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1107 aa     Download sequence    Send to blast
MKAPPTGFLA NPAEGDRKSI NSELWHACAG PLVSLPPIGS LVVYFPQGHS EQVAASMQKE  60
TDFIPSYPNL PSKLICVLHN VTLHADPETD EVYAQMTLQP VNKYDKEALL ASDMGLKHSR  120
QPAEFFCKTL TASDTSTHGG FSVPRRAAEK IFPPLDFSMQ PPAQELVARD LHENAWTFRH  180
IYRGQPKRHL LTTGWSVFVS TKRLFAGDSV LFIRDVKSQL LLGLRRANRQ QPALSSSVIS  240
SDSMHIGILA AAAHAAANFS PFTIFYNPRA SPSEFVVPLA KYYKAMYTQV SLGMRFRMMF  300
ETEESGVRRY MGTVTGISDL DPVRWKNSQW RNLQVGWDES TAGERPRRVS IWEIEPVVSP  360
FFICPPPFFR PRFPKQPGMP DDDSDVENAF KRAMPWLGDD FGMRGTPSSI FPGLSLVQWM  420
NMQQSNQFPA AQSGFFPSTV SSNPLHNNLS IDDPSKLLNF QAPVLPAPNM QFNKANPNQV  480
NQLPQAPTTW PQQILQTPLN QHQQQQPQQQ LQQQQPQQPK QQPQPQSHLL HQQQPQPQPS  540
PKQQQHIHQE QRQQPQQQQP LQQQPTLPPQ VINGIVAPNQ ISNQNLHQPA VYSHLQQQQL  600
LTSNSLSTQT TLSAHMTSYP LTSLPQDTRV QQQMEQQPNL MQRQQQQTQL QQSLSQRTQQ  660
QPQILQLSQQ GLSEQLQLQL LQKLQQQQQQ QSAQQLLSAA GSLLQPPMLQ QQQTHQQNQP  720
LQQLPLSQSQ VQPLGGNGFS TSMFVQPQQL SVHQSQSQNK QLMAMRSNSG LIDGDAPPCS  780
TLSSTNNCQV SPSNLINRSH HVPSILMTDP VVEPPSTLAQ ELLSKPDIQI KHEPPTSRGL  840
DQSKYKSSVT DQLEASSSGT SYCLDAGTLQ HNASLAFLEG DVQSHSRNNL PFTANIDGLA  900
PETLLTREYD SQKDLQNMLS NYGGNPRDID TELSTAAISC QSFGVPNIPF KTGCSNDVAI  960
NETGVLNGGL WTNQTQRMRT YTKVQKRGSV GRSIDVTRYK GYDELRHDLA RMFGIEGQLE  1020
DPQSSDWKLV YVDHENDILL VGDDPWEEFV SCVQSIKILS SAEVQQMSLD GNLGNVSVPN  1080
QACSGTENGN AWRGHYDDTS AVSFNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1701535545388Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012444798.10.0PREDICTED: auxin response factor 19-like isoform X1
TrEMBLA0A0D2RTN20.0A0A0D2RTN2_G
STRINGPGSC0003DMT4000355920.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26292665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]